GarKS is a multipeptide bacteriocin composed of three small similar peptides with a size between 32 and 34 amino acids. Potent activity against many pathogenic Gram-positive bacteria (Listeria, Enterococcus, Bacillus, and Staphylococcus), representing a great potential for antimicrobial applications.
Price range: €200.00 through €1,600.00
GarKS is a multipeptide bacteriocin composed of three small similar peptides with a size between 32 and 34 amino acids. Potent activity against many pathogenic Gram-positive bacteria (Listeria, Enterococcus, Bacillus, and Staphylococcus), representing a great potential for antimicrobial applications.
| Description | Name Garvicin KS Class Leaderless three-peptide bacteriocin Sequence gakA: MGAIIKAGAKIVGKGVLGGGASWLGWNVGEKIWK gakB: MGAIIKAGAKIIGKGLLGGAAGGATYGGLKKIFG gakC: MGAIIKAGAKIVGKGALTGGGVWLAEKLFGGK Molecular Formula: C161H259N43O39S C145H247N39O37S C143H240N38O36S Molecular Weight 3453.38 g/mol 3161.08 g/mol 3099.98 g/mol Purity >95% Other properties Heat-stable, protease-sensitive. Stable for at least 1 year at room temperature |
|---|---|
| Sizes | 0,5 mg, 1 mg, 5 mg |
| References | 1. Thapa RK, Winther-Larsen HC, Diep DB, Tønnesen HH. Preformulation studies on novel garvicin KS peptides for topical applications. European Journal of Pharmaceutical Sciences. 2020;151:105333. 2. Telke AA, Ovchinnikov KV, Vuoristo KS, Mathiesen G, Thorstensen T, Diep DB. Over 2000-fold increased production of the leaderless bacteriocin garvicin KS by increasing gene dose and optimization of culture conditions. Frontiers in Microbiology. 2019;10:389. 3.Ovchinnikov KV, Chi H, Mehmeti I, Holo H, Nes IF, Diep DB. Novel group of leaderless multipeptide bacteriocins from gram-positive bacteria. Applied and environmental microbiology. 2016;82(17):5216-24. |
Select at least 2 products
to compare
