Description
Enterocin K1 (EntK1)is a leaderless bacteriocin being particularly active against Enterococcus faecium, including nosocomial multidrug resistant isolates.
Enterocin K1 (EntK1)
Enterocin K1 (EntK1)is a leaderless bacteriocin being particularly active against Enterococcus faecium, including nosocomial multidrug resistant isolates.
Price range: €200.00 through €1,600.00
Additional information
| Description | Name Enterocin K1 Class Leaderless three-peptide bacteriocin Sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC Molecular Formula: C218H321N53O51S2 Molecular Weight 4564.6 g/mol Purity >95% Other properties Heat-stable, protease-sensitive. Stable for at least 1 year at room temperature |
|---|---|
| Sizes | 0,5 mg, 1 mg, 5 mg |
| References | 1. Ovchinnikov KV, Kristiansen PE, Straume D, Jensen MS, Aleksandrzak-Piekarczyk T, Nes IF, et al. The leaderless bacteriocin enterocin K1 is highly potent against Enterococcus faecium: a study on structure, target spectrum and receptor. Frontiers in microbiology. 2017;8:774. |
